INTS9 Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2086175
Artikelname: |
INTS9 Antibody - C-terminal region : HRP, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2086175 |
Hersteller Artikelnummer: |
orb2086175 |
Alternativnummer: |
BYT-ORB2086175-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human INTS9 |
Konjugation: |
HRP |
Alternative Synonym: |
INT9, RC74, CPSF2L |
INTS9 Antibody - C-terminal region : HRP |
Klonalität: |
Polyclonal |
Molekulargewicht: |
71kDa |
NCBI: |
060720 |
UniProt: |
Q9NV88 |
Puffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Formulierung: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Sequenz: |
Synthetic peptide located within the following region: TKDNKHLLQPPPRPAQPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFV |