INTS9 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2086177
Artikelname: |
INTS9 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2086177 |
Hersteller Artikelnummer: |
orb2086177 |
Alternativnummer: |
BYT-ORB2086177-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human INTS9 |
Konjugation: |
Biotin |
Alternative Synonym: |
INT9, RC74, CPSF2L |
INTS9 Antibody - C-terminal region : Biotin |
Klonalität: |
Polyclonal |
Molekulargewicht: |
71kDa |
NCBI: |
060720 |
UniProt: |
Q9NV88 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequenz: |
Synthetic peptide located within the following region: TKDNKHLLQPPPRPAQPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFV |