INTS2 Antibody - N-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086178
Artikelname: INTS2 Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086178
Hersteller Artikelnummer: orb2086178
Alternativnummer: BYT-ORB2086178-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human INTS2
Konjugation: HRP
Alternative Synonym: INT2, KIAA1287
INTS2 Antibody - N-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 134kDa
NCBI: 065799
UniProt: Q9H0H0
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: VCRGLIKNGERQDEESLGGRRRTDALRFLCKMNPSQALKVRGMVVEECHL