INO80C Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2086182
Artikelname: |
INO80C Antibody - N-terminal region : FITC, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2086182 |
Hersteller Artikelnummer: |
orb2086182 |
Alternativnummer: |
BYT-ORB2086182-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human INO80C |
Konjugation: |
FITC |
Alternative Synonym: |
IES6, hIes6, C18orf37 |
INO80C Antibody - N-terminal region : FITC |
Klonalität: |
Polyclonal |
Molekulargewicht: |
21kDa |
UniProt: |
Q6PI98 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequenz: |
Synthetic peptide located within the following region: VATTSTPGIVRNSKKRPASPSHNGSSGGGYGASKKKKASASSFAQGISME |