HSD11B1L Antibody - C-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086205
Artikelname: HSD11B1L Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086205
Hersteller Artikelnummer: orb2086205
Alternativnummer: BYT-ORB2086205-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human HSD11B1L
Konjugation: HRP
Alternative Synonym: HSD3, HSD1L, 11-DH3, SCDR10, SCDR10B, SDR26C2, 11-beta-HSD3
HSD11B1L Antibody - C-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 34kDa
UniProt: Q7Z5J1
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: PPTVPGARTLTETPLRGWPQPKMKSSRQKSKTEKNDGHLEPVTAWEVQVP