HSD11B1L Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2086207
| Artikelname: |
HSD11B1L Antibody - C-terminal region : Biotin, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2086207 |
| Hersteller Artikelnummer: |
orb2086207 |
| Alternativnummer: |
BYT-ORB2086207-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human HSD11B1L |
| Konjugation: |
Biotin |
| Alternative Synonym: |
HSD3, HSD1L, 11-DH3, SCDR10, SCDR10B, SDR26C2, 11-beta-HSD3 |
| HSD11B1L Antibody - C-terminal region : Biotin |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
34kDa |
| UniProt: |
Q7Z5J1 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: PPTVPGARTLTETPLRGWPQPKMKSSRQKSKTEKNDGHLEPVTAWEVQVP |
