HIST1H4A Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2086217
Artikelname: |
HIST1H4A Antibody - N-terminal region : HRP, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2086217 |
Hersteller Artikelnummer: |
orb2086217 |
Alternativnummer: |
BYT-ORB2086217-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human HIST1H4A |
Konjugation: |
HRP |
Alternative Synonym: |
H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4FA, H4-16, H4C11, H4C12, H4C13, H4C14, H4C15, HIST1H4A |
HIST1H4A Antibody - N-terminal region : HRP |
Klonalität: |
Polyclonal |
Molekulargewicht: |
11kDa |
NCBI: |
778224 |
UniProt: |
P62805 |
Puffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Formulierung: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Sequenz: |
Synthetic peptide located within the following region: LGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK |