HIST1H4A Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2086217
| Artikelname: |
HIST1H4A Antibody - N-terminal region : HRP, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2086217 |
| Hersteller Artikelnummer: |
orb2086217 |
| Alternativnummer: |
BYT-ORB2086217-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human HIST1H4A |
| Konjugation: |
HRP |
| Alternative Synonym: |
H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4FA, H4-16, H4C11, H4C12, H4C13, H4C14, H4C15, HIST1H4A |
| HIST1H4A Antibody - N-terminal region : HRP |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
11kDa |
| NCBI: |
778224 |
| UniProt: |
P62805 |
| Puffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Formulierung: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Sequenz: |
Synthetic peptide located within the following region: LGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK |
