HIST1H2AE Antibody - N-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086222
Artikelname: HIST1H2AE Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086222
Hersteller Artikelnummer: orb2086222
Alternativnummer: BYT-ORB2086222-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human HIST1H2AE
Konjugation: Biotin
Alternative Synonym: H2A.1, H2A.2, H2A/a, H2AC4, H2AFA, HIST1H2AE
HIST1H2AE Antibody - N-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 066390
UniProt: P04908
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAA