HIST1H2AE Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2086222
Artikelname: |
HIST1H2AE Antibody - N-terminal region : Biotin, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2086222 |
Hersteller Artikelnummer: |
orb2086222 |
Alternativnummer: |
BYT-ORB2086222-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human HIST1H2AE |
Konjugation: |
Biotin |
Alternative Synonym: |
H2A.1, H2A.2, H2A/a, H2AC4, H2AFA, HIST1H2AE |
HIST1H2AE Antibody - N-terminal region : Biotin |
Klonalität: |
Polyclonal |
Molekulargewicht: |
14kDa |
NCBI: |
066390 |
UniProt: |
P04908 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequenz: |
Synthetic peptide located within the following region: GKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAA |