HIGD2A Antibody - N-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086223
Artikelname: HIGD2A Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086223
Hersteller Artikelnummer: orb2086223
Alternativnummer: BYT-ORB2086223-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human HIGD2A
Konjugation: HRP
Alternative Synonym: RCF1b
HIGD2A Antibody - N-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 11kDa
NCBI: 620175
UniProt: Q9BW72
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: EGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAALTYGLYSFHRGN