HEATR8 Antibody - N-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086232
Artikelname: HEATR8 Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086232
Hersteller Artikelnummer: orb2086232
Alternativnummer: BYT-ORB2086232-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human HEATR8
Konjugation: HRP
Alternative Synonym: HEATR8, C1orf175
HEATR8 Antibody - N-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 68kDa
NCBI: 001034553
UniProt: Q68CQ1
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: LDLDSKDVSRPDSQGRLCPASNPILSPSSTEAPRLSSGNHPQSNSEDAFK