HEATR8 Antibody - N-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086233
Artikelname: HEATR8 Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086233
Hersteller Artikelnummer: orb2086233
Alternativnummer: BYT-ORB2086233-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human HEATR8
Konjugation: FITC
Alternative Synonym: HEATR8, C1orf175
HEATR8 Antibody - N-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 68kDa
NCBI: 001034553
UniProt: Q68CQ1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LDLDSKDVSRPDSQGRLCPASNPILSPSSTEAPRLSSGNHPQSNSEDAFK