HEATR6 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086236
Artikelname: HEATR6 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086236
Hersteller Artikelnummer: orb2086236
Alternativnummer: BYT-ORB2086236-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human HEATR6
Konjugation: FITC
Alternative Synonym: ABC1
HEATR6 Antibody - C-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 45kDa
NCBI: 071353
UniProt: Q6AI08
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: YPTPLPQYDGRTPIKPQQSESSASRPTLNKKKKSKVKPKKIQQGEEEEKE