HEATR3 Antibody - N-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086238
Artikelname: HEATR3 Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086238
Hersteller Artikelnummer: orb2086238
Alternativnummer: BYT-ORB2086238-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human HEATR3
Konjugation: HRP
Alternative Synonym: SYO1
HEATR3 Antibody - N-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 891552
UniProt: Q7Z4Q2
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: KECSAGLDSNEMSLQEKKDQNRNSIENIANETVNVLWNICECSSRAVSIF