HEATR3 Antibody - N-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086239
Artikelname: HEATR3 Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086239
Hersteller Artikelnummer: orb2086239
Alternativnummer: BYT-ORB2086239-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human HEATR3
Konjugation: FITC
Alternative Synonym: SYO1
HEATR3 Antibody - N-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 891552
UniProt: Q7Z4Q2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KECSAGLDSNEMSLQEKKDQNRNSIENIANETVNVLWNICECSSRAVSIF