HAUS2 Antibody - N-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086245
Artikelname: HAUS2 Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086245
Hersteller Artikelnummer: orb2086245
Alternativnummer: BYT-ORB2086245-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human HAUS2
Konjugation: FITC
Alternative Synonym: CEP27, C15orf25, HsT17025
HAUS2 Antibody - N-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 001123919
UniProt: Q9NVX0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: AEIYQKNLEIELLKLEKDTADVVHPFFLEMKSCYVAQAGLELMASILPFQ