GUCY1A2 Antibody - N-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086250
Artikelname: GUCY1A2 Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086250
Hersteller Artikelnummer: orb2086250
Alternativnummer: BYT-ORB2086250-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GUCY1A2
Konjugation: HRP
Alternative Synonym: GC-SA2, GUC1A2
GUCY1A2 Antibody - N-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 81kDa
NCBI: 001243353
UniProt: P33402
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: KNFHNISNRCSYADHSNKEEIEDVSGILQCTANILGLKFEEIQKRFGEEF