GRXCR2 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086257
Artikelname: GRXCR2 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086257
Hersteller Artikelnummer: orb2086257
Alternativnummer: BYT-ORB2086257-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GRXCR2
Konjugation: FITC
Alternative Synonym: DFNB101
GRXCR2 Antibody - C-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 001073985
UniProt: A6NFK2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PLVEAESTLPQNRYTQEGDIPEDSCFHCRGSGSATCSLCHGSKFSMLANR