GREB1 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086264
Artikelname: GREB1 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086264
Hersteller Artikelnummer: orb2086264
Alternativnummer: BYT-ORB2086264-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GREB1
Konjugation: Biotin
GREB1 Antibody - N-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 683701
UniProt: Q4ZG55
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LGFSGNCVGCGKKGFCYFTEFSNHINLKLTTQPKKQKHLKYYLVRNAQGT