GRAP Antibody - N-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086267
Artikelname: GRAP Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086267
Hersteller Artikelnummer: orb2086267
Alternativnummer: BYT-ORB2086267-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GRAP
Konjugation: Biotin
Alternative Synonym: DFNB114
GRAP Antibody - N-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 006604
UniProt: Q13588
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SDELAFNKGDTLKILNMEDDQNWYKAELRGVEGFIPKNYIRVKPHPWYSG