GPR89A Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086275
Artikelname: GPR89A Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086275
Hersteller Artikelnummer: orb2086275
Alternativnummer: BYT-ORB2086275-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR89A
Konjugation: FITC
Alternative Synonym: GPHR, GPR89, SH120, GPR89B, UNQ192
GPR89A Antibody - C-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 53kDa
NCBI: 057418
UniProt: B7ZAQ6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LEYRTIITEVLGELQFNFYHRWFDVIFLVSALSSILFLYLAHKQAPEKQM