GPATCH3 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2086278
| Artikelname: |
GPATCH3 Antibody - C-terminal region : FITC, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2086278 |
| Hersteller Artikelnummer: |
orb2086278 |
| Alternativnummer: |
BYT-ORB2086278-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPATCH3 |
| Konjugation: |
FITC |
| Alternative Synonym: |
GPATC3 |
| GPATCH3 Antibody - C-terminal region : FITC |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
59kDa |
| NCBI: |
071361 |
| UniProt: |
Q96I76 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: KGIGRKVMERQGWAEGQGLGCRCSGVPEALDSDGQHPRCKRGLGYHGEKL |
