GLIPR2 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2086300
Artikelname: |
GLIPR2 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2086300 |
Hersteller Artikelnummer: |
orb2086300 |
Alternativnummer: |
BYT-ORB2086300-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of human GLIPR2 |
Konjugation: |
Biotin |
Alternative Synonym: |
GAPR1, GAPR-1, C9orf19 |
GLIPR2 Antibody - C-terminal region : Biotin |
Klonalität: |
Polyclonal |
Molekulargewicht: |
38kDa |
NCBI: |
071738 |
UniProt: |
Q9H4G4 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequenz: |
Synthetic peptide located within the following region: EVADRWYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSS |