GLB1L3 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086303
Artikelname: GLB1L3 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086303
Hersteller Artikelnummer: orb2086303
Alternativnummer: BYT-ORB2086303-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GLB1L3
Konjugation: Biotin
GLB1L3 Antibody - C-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 001073876
UniProt: Q8NCI6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KHSGIVTSYDYDAVLTEAGDYTEKYLKLQKLFQSVSATPLPRVPKLPPKA