GAB4 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086315
Artikelname: GAB4 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086315
Hersteller Artikelnummer: orb2086315
Alternativnummer: BYT-ORB2086315-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GAB4
Konjugation: Biotin
GAB4 Antibody - C-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 62kDa
NCBI: 001032903
UniProt: Q2WGN9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GTSSSAPPRSTGNIHYAALDFQPSKPSIGSVTSGKKVDYVQVDLEKTQAL