FNDC7 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2086324
| Artikelname: |
FNDC7 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2086324 |
| Hersteller Artikelnummer: |
orb2086324 |
| Alternativnummer: |
BYT-ORB2086324-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human FNDC7 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
RP11-293A10.2 |
| FNDC7 Antibody - N-terminal region : Biotin |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
75kDa |
| NCBI: |
001138409 |
| UniProt: |
Q5VTL7 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: PGTVTGLKAATWYEITIRSISAAGRSQASPPKQAKTVLAAPILEVSSPSS |
