FGD5 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2086333
| Artikelname: |
FGD5 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2086333 |
| Hersteller Artikelnummer: |
orb2086333 |
| Alternativnummer: |
BYT-ORB2086333-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FGD5 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
ZFYVE23 |
| FGD5 Antibody - C-terminal region : Biotin |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
59kDa |
| UniProt: |
Q6ZNL6 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: FVIKGKVLYTYMASEDKVALESMPLLGFTIAPEKEEGSSEVGPIFHLYHK |
