FBXO46 Antibody - C-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086334
Artikelname: FBXO46 Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086334
Hersteller Artikelnummer: orb2086334
Alternativnummer: BYT-ORB2086334-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FBXO46
Konjugation: HRP
Alternative Synonym: Fbx46, FBXO34L, 20D7-FC4
FBXO46 Antibody - C-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 64kDa
NCBI: 001073938
UniProt: Q6PJ61
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: VDVVVTGVVDECIFFGKDGTKNVKEETVCLTVSPEEPPPPGQLFFLQNRG