FBLN7 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086341
Artikelname: FBLN7 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086341
Hersteller Artikelnummer: orb2086341
Alternativnummer: BYT-ORB2086341-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FBLN7
Konjugation: FITC
Alternative Synonym: TM14
FBLN7 Antibody - C-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 33kDa
UniProt: Q53RD9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VMQRSDRQTGDLILVQNLEGPQTLEVDVDMSEYLDRSFQANHVSKVTIFV