HGH1 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086348
Artikelname: HGH1 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086348
Hersteller Artikelnummer: orb2086348
Alternativnummer: BYT-ORB2086348-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM203A
Konjugation: Biotin
Alternative Synonym: BRP16, BRP16L, FAM203A, FAM203B, C8orf30A, C8orf30B
HGH1 Antibody - C-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 41kDa
NCBI: 057542
UniProt: Q9BTY7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ADIRKMLVEAIMLLTATAPGRQQVRDQGAYLILRELHSWEPEPDVRTACE