FAM198B Antibody - N-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086350
Artikelname: FAM198B Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086350
Hersteller Artikelnummer: orb2086350
Alternativnummer: BYT-ORB2086350-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM198B
Konjugation: FITC
Alternative Synonym: ENED, AD021, AD036, C4orf18, FAM198B
FAM198B Antibody - N-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 58kDa
NCBI: 001026870
UniProt: Q6UWH4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LAPPESQGNGSTLQPNVVYITLRSKRSKPANIRGTVKPKRRKKHAVASAA