ERICH6B Antibody - C-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086352
Artikelname: ERICH6B Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086352
Hersteller Artikelnummer: orb2086352
Alternativnummer: BYT-ORB2086352-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM194B
Konjugation: HRP
Alternative Synonym: FAM194B
ERICH6B Antibody - C-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 75kDa
UniProt: Q5W0A0
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: LKKNYEKFKETILRIKRRREAQKLTEMTSFTFHLMSKPTPEKPETEEIQK