ERICH6B Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086353
Artikelname: ERICH6B Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086353
Hersteller Artikelnummer: orb2086353
Alternativnummer: BYT-ORB2086353-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM194B
Konjugation: FITC
Alternative Synonym: FAM194B
ERICH6B Antibody - C-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 75kDa
UniProt: Q5W0A0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LKKNYEKFKETILRIKRRREAQKLTEMTSFTFHLMSKPTPEKPETEEIQK