FAM193A Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2086357
Artikelname: |
FAM193A Antibody - C-terminal region : Biotin, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2086357 |
Hersteller Artikelnummer: |
orb2086357 |
Alternativnummer: |
BYT-ORB2086357-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM193A |
Konjugation: |
Biotin |
Alternative Synonym: |
C4orf8, RES4-22 |
FAM193A Antibody - C-terminal region : Biotin |
Klonalität: |
Polyclonal |
Molekulargewicht: |
139kDa |
NCBI: |
003695 |
UniProt: |
P78312 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequenz: |
Synthetic peptide located within the following region: EHQQNSKLVLAESPQPKGKNKKNKKKKGDRVNNSIDGVSLLLPSLGYNGA |