FAM193A Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086357
Artikelname: FAM193A Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086357
Hersteller Artikelnummer: orb2086357
Alternativnummer: BYT-ORB2086357-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM193A
Konjugation: Biotin
Alternative Synonym: C4orf8, RES4-22
FAM193A Antibody - C-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 139kDa
NCBI: 003695
UniProt: P78312
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EHQQNSKLVLAESPQPKGKNKKNKKKKGDRVNNSIDGVSLLLPSLGYNGA