FAM192A Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086359
Artikelname: FAM192A Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086359
Hersteller Artikelnummer: orb2086359
Alternativnummer: BYT-ORB2086359-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM192A
Konjugation: FITC
Alternative Synonym: CDA10, NIP30, PIP30, CDA018, FAM192A, C16orf94
FAM192A Antibody - C-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 079222
UniProt: Q9GZU8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KPIETKNKFSQAKLLAGAVKHKSSESGNSVKRLKPDPEPDDKNQEPSSCK