FAM185A Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086369
Artikelname: FAM185A Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086369
Hersteller Artikelnummer: orb2086369
Alternativnummer: BYT-ORB2086369-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM185A
Konjugation: Biotin
FAM185A Antibody - C-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 29kDa
NCBI: 001138741
UniProt: Q8N0U4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EVHVQEMAEVRKDDVVTVTGLMNQASKREKWIKADAPKGTVSFRRQSWFQ