FAM184A Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086371
Artikelname: FAM184A Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086371
Hersteller Artikelnummer: orb2086371
Alternativnummer: BYT-ORB2086371-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human FAM184A
Konjugation: FITC
Alternative Synonym: C6orf60
FAM184A Antibody - C-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 001093881
UniProt: Q8NB25
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TNFNKVFNSSPTVGVINPLAKQKKKNDKSPTNRFVSVPNLSALESGGVGN