FAM177B Antibody - N-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086383
Artikelname: FAM177B Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086383
Hersteller Artikelnummer: orb2086383
Alternativnummer: BYT-ORB2086383-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM177B
Konjugation: FITC
FAM177B Antibody - N-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 13kDa
UniProt: A6PVY3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LDLEKSVPSKKTTPKRIIHFVDGDIMEEYSTEEEEEEEKEEQSTNSTLDP