FAM177B Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2086387
| Artikelname: |
FAM177B Antibody - C-terminal region : Biotin, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2086387 |
| Hersteller Artikelnummer: |
orb2086387 |
| Alternativnummer: |
BYT-ORB2086387-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM177B |
| Konjugation: |
Biotin |
| FAM177B Antibody - C-terminal region : Biotin |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
18kDa |
| NCBI: |
997351 |
| UniProt: |
A6PVY3 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: YRIQNKKSDNKSERRGSKAQAAEVPNEKCHLEAGVQEYGTIQQDVTEAIP |
