FAM171A2 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2086389
| Artikelname: |
FAM171A2 Antibody - C-terminal region : FITC, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2086389 |
| Hersteller Artikelnummer: |
orb2086389 |
| Alternativnummer: |
BYT-ORB2086389-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM171A2 |
| Konjugation: |
FITC |
| FAM171A2 Antibody - C-terminal region : FITC |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
84kDa |
| NCBI: |
940877 |
| UniProt: |
A8MVW0 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: SSRSSASELRRDSLTSPEDELGAEVGDEAGDKKSPWQRREERPLMVFNVK |
