FAM171A2 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086390
Artikelname: FAM171A2 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086390
Hersteller Artikelnummer: orb2086390
Alternativnummer: BYT-ORB2086390-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM171A2
Konjugation: Biotin
FAM171A2 Antibody - C-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 84kDa
NCBI: 940877
UniProt: A8MVW0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SSRSSASELRRDSLTSPEDELGAEVGDEAGDKKSPWQRREERPLMVFNVK