GLUL Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2098502
Artikelname: |
GLUL Antibody - C-terminal region : HRP, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2098502 |
Hersteller Artikelnummer: |
orb2098502 |
Alternativnummer: |
BYT-ORB2098502-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human GLUL |
Konjugation: |
HRP |
Alternative Synonym: |
GS, GLNS, PIG43, PIG59 |
GLUL Antibody - C-terminal region : HRP |
Klonalität: |
Polyclonal |
Molekulargewicht: |
42kDa |
NCBI: |
002056 |
UniProt: |
P15104 |
Puffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Formulierung: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Sequenz: |
Synthetic peptide located within the following region: TGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFS |