GLUL Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098503
Artikelname: GLUL Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098503
Hersteller Artikelnummer: orb2098503
Alternativnummer: BYT-ORB2098503-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GLUL
Konjugation: FITC
Alternative Synonym: GS, GLNS, PIG43, PIG59
GLUL Antibody - C-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 002056
UniProt: P15104
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFS