GADL1 Antibody - middle region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098505
Artikelname: GADL1 Antibody - middle region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098505
Hersteller Artikelnummer: orb2098505
Alternativnummer: BYT-ORB2098505-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human GADL1
Konjugation: HRP
Alternative Synonym: ADC, CSADC, HuADC, HuCSADC
GADL1 Antibody - middle region : HRP
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 997242
UniProt: Q6ZQY3
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: DLLKKCYSAKASYLFQQDKFYDVSYDTGDKSIQCSRRPDAFKFWMTWKAL