GADL1 Antibody - middle region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098507
Artikelname: GADL1 Antibody - middle region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098507
Hersteller Artikelnummer: orb2098507
Alternativnummer: BYT-ORB2098507-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human GADL1
Konjugation: Biotin
Alternative Synonym: ADC, CSADC, HuADC, HuCSADC
GADL1 Antibody - middle region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 997242
UniProt: Q6ZQY3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DLLKKCYSAKASYLFQQDKFYDVSYDTGDKSIQCSRRPDAFKFWMTWKAL