ALDH5A1 Antibody - middle region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098515
Artikelname: ALDH5A1 Antibody - middle region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098515
Hersteller Artikelnummer: orb2098515
Alternativnummer: BYT-ORB2098515-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ALDH5A1
Konjugation: FITC
Alternative Synonym: SSDH, SSADH
ALDH5A1 Antibody - middle region : FITC
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 001071
UniProt: P51649
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: AFFLEWFSEEARRVYGDIIHTPAKDRRALVLKQPIGVAAVITPWNFPSAM