COCH Antibody - N-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098517
Artikelname: COCH Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098517
Hersteller Artikelnummer: orb2098517
Alternativnummer: BYT-ORB2098517-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human COCH
Konjugation: HRP
Alternative Synonym: DFNA9, COCH5B2, DFNB110, COCH-5B2
COCH Antibody - N-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 001128530
UniProt: O43405
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: AHPPTGKRLKKTPEKKTGNKDCKADIAFLIDGSFNIGQRRFNLQKNFVGK