COCH Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098522
Artikelname: COCH Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098522
Hersteller Artikelnummer: orb2098522
Alternativnummer: BYT-ORB2098522-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human COCH
Konjugation: Biotin
Alternative Synonym: DFNA9, COCH5B2, DFNB110, COCH-5B2
COCH Antibody - C-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 001128530
UniProt: O43405
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VAWAPLDDLKDMASKPKESHAFFTREFTGLEPIVSDVIRGICRDFLESQQ