BSND Antibody - middle region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098527
Artikelname: BSND Antibody - middle region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098527
Hersteller Artikelnummer: orb2098527
Alternativnummer: BYT-ORB2098527-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BSND
Konjugation: FITC
Alternative Synonym: BART, DFNB73
BSND Antibody - middle region : FITC
Klonalität: Polyclonal
Molekulargewicht: 35 kDa
NCBI: 476517
UniProt: Q8WZ55
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDD