ZDHHC3 Antibody - C-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098532
Artikelname: ZDHHC3 Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098532
Hersteller Artikelnummer: orb2098532
Alternativnummer: BYT-ORB2098532-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ZDHHC3
Konjugation: HRP
Alternative Synonym: GODZ, DHHC3, DHHC-3, ZNF373
ZDHHC3 Antibody - C-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 001128651
UniProt: Q9NYG2
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: MFGTQVHSICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGWASP