OPRL1 Antibody - middle region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2098538
Artikelname: OPRL1 Antibody - middle region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2098538
Hersteller Artikelnummer: orb2098538
Alternativnummer: BYT-ORB2098538-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OPRL1
Konjugation: HRP
Alternative Synonym: NOP, OOR, KOR3, NOPr, OPRL, ORL1, KOR-3, NOCIR
OPRL1 Antibody - middle region : HRP
Klonalität: Polyclonal
Molekulargewicht: 41kDa
NCBI: 872588
UniProt: P79292
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: ISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQ